NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2007315643

Scaffold 2007315643


Overview

Basic Information
Taxon OID2007309000 Open in IMG/M
Scaffold ID2007315643 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone Bath Hot Springs, Wyoming, USA - Filamentous sample
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)746
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Thermoproteales → Thermoproteaceae → Pyrobaculum → unclassified Pyrobaculum → Pyrobaculum sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.560318Long. (o)-110.8338344Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013155Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
2007322841F013155AGGMEFYQVAVIAIALANLAVTVWLLRLLLPVWQTLRKVVFAMDSYDFDRLAKQFLSNEKPLAETIDVKVSEKKEEGYRELTVTRVYKKPLDAKEVWEGIVRQMAEKLQ

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.